PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00019.1.p
Common NameEUGRSUZ_J00019, LOC104420893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 346aa    MW: 37018.3 Da    PI: 9.765
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38.3e-3967127262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +e  lkcprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  Eucgr.J00019.1.p  67 PEPGLKCPRCDSTNTKFCYFNNYSLTQPRHFCKSCRRYWTRGGALRNVPVGGGCRRNKRSK 127
                       56789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3251116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.76771125IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3271125IPR003851Zinc finger, Dof-type
PROSITE patternPS01361073109IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWPQQQA NQQSGASSEI PQLPLPPPPL PAGGGGTGSI RPGSMADRAR  60
LAKVPQPEPG LKCPRCDSTN TKFCYFNNYS LTQPRHFCKS CRRYWTRGGA LRNVPVGGGC  120
RRNKRSKGSR SKSPVTTERQ AASGSTTSGS GVGVSSTAAA TDIIGHLVPP PSQLPFLPPL  180
HNLNDFISSD MGLNFGPGAQ SQLAVARRGV VPDVEFQIGS SSGGGSQLLP NGLSDHQWRL  240
NQMHHQVQQF PFFANLQTPS YPLEGEVNAS ELLRNKPLDH STGIAHQMGS TVKMEENQRL  300
NLSRNLNFSS GVSSSSNNNE QFWGGNNNAW TDLSGFSSSS ASHLL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00019.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030969.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
TrEMBLA0A059A9040.0A0A059A904_EUCGR; Uncharacterized protein
STRINGVIT_13s0019g01410.t012e-95(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.13e-38Dof family protein